Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)
This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin heavy variable 3-15 IGHV3-15
UniProt
A0A0B4J1V0
Expression Region
20-119
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3775-500 1x 500 µL
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
