Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JHSB3 , approximately 80%
TRC-J211030-2.5MG 2.5 mg

JHSB3 , approximately 80%

Sign In for Pricing
View Details
Mouse Ect2 activation kit by CRISPRa
GA201171 1 Kit

Mouse Ect2 activation kit by CRISPRa

Sign In for Pricing
View Details
Kallikrein 2 (KLK2) Human Gene Knockout Kit (CRISPR)
KN202667LP 1 Kit

Kallikrein 2 (KLK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Homovanillic Acid-d5
TRC-H669506-1MG 1 mg

Homovanillic Acid-d5

Sign In for Pricing
View Details
Anti-Psb27-H1 | Photosystem II repair protein 27
AS22 4788 50 µg

Anti-Psb27-H1 | Photosystem II repair protein 27

Sign In for Pricing
View Details
Txn2 Mouse Gene Knockout Kit (CRISPR)
KN318507 1 Kit

Txn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details