Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS1 Recombinant Rabbit Monoclonal Antibody [JE30-36]
HA721035 100 µL

PIAS1 Recombinant Rabbit Monoclonal Antibody [JE30-36]

Sign In for Pricing
View Details
SCY1 like 3 (SCYL3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA500487AM 100 µL

SCY1 like 3 (SCYL3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

Sign In for Pricing
View Details
OSGEP (NM_017807) Human Over-expression Lysate
LY402616 100 µg

OSGEP (NM_017807) Human Over-expression Lysate

Sign In for Pricing
View Details
ST3GAL6 Rabbit Polyclonal Antibody
TA362200 100 µL

ST3GAL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details