Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jo-1 (Histidyl t-RNA Synthetase)
MBS620859-01 2 mL

Jo-1 (Histidyl t-RNA Synthetase)

Sign In for Pricing
View Details
Jo-1 (Histidyl t-RNA Synthetase)
MBS620859-02 5x 2 mL

Jo-1 (Histidyl t-RNA Synthetase)

Sign In for Pricing
View Details
Human Endothelin 1 (EDN1) ELISA Kit
DL-EDN1-Hu-01 48 Tests

Human Endothelin 1 (EDN1) ELISA Kit

Sign In for Pricing
View Details
Human Endothelin 1 (EDN1) ELISA Kit
DL-EDN1-Hu-02 96 Tests

Human Endothelin 1 (EDN1) ELISA Kit

Sign In for Pricing
View Details
UPA (E2M6I) Rabbit Monoclonal Antibody
CST 15800T 20 µL

UPA (E2M6I) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-TBKBP1 Antibody Picoband® PE Conjugated
A10984-1-PE 100 µg/Vial

Anti-TBKBP1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details