Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINF2 (Alpha-2-antiplasmin, Alpha-2-AP, Alpha-2-plasmin Inhibitor, Alpha-2-PI, Serpin F2, AAP, PLI)
139168 200 µL

SERPINF2 (Alpha-2-antiplasmin, Alpha-2-AP, Alpha-2-plasmin Inhibitor, Alpha-2-PI, Serpin F2, AAP, PLI)

Sign In for Pricing
View Details
PRL Polyclonal Antibody, HRP Conjugated
bs-0508R-HRP-TR 20 µL

PRL Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Palverafusp alfa Antibody
orb2803461-01 1 mg

Palverafusp alfa Antibody

Sign In for Pricing
View Details
Palverafusp alfa Antibody
orb2803461-02 5 mg

Palverafusp alfa Antibody

Sign In for Pricing
View Details
Adk (NM_134079) Mouse Tagged ORF Clone
MG205531 10 µg

Adk (NM_134079) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant human ETNK2 protein
ATGP3049-050 50 µg

Recombinant human ETNK2 protein

Sign In for Pricing
View Details