Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373)

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SGSM1 Antibody [Alexa Fluor 350]
NBP2-81792AF350 0.1 mL

Rabbit Polyclonal SGSM1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
3β-Hydroxy-hop-22 (29) -ene
orb1745038-01 25 mg

3β-Hydroxy-hop-22 (29) -ene

Sign In for Pricing
View Details
3β-Hydroxy-hop-22 (29) -ene
orb1745038-02 50 mg

3β-Hydroxy-hop-22 (29) -ene

Sign In for Pricing
View Details
3β-Hydroxy-hop-22 (29) -ene
orb1745038-03 100 mg

3β-Hydroxy-hop-22 (29) -ene

Sign In for Pricing
View Details
Recombinant Human IL-2 (aldesleukin)
FY-PN53147 10 µg

Recombinant Human IL-2 (aldesleukin)

Sign In for Pricing
View Details
Recombinant Rat Cathepsin D (Ctsd)
CSB-EP006187RA-01 20 µg

Recombinant Rat Cathepsin D (Ctsd)

Sign In for Pricing
View Details