Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Aflatoxin B1 aldehyde reductase member 3 (AKR7A3) ELISA Kit
GTR10316845 96 Well

Canine Aflatoxin B1 aldehyde reductase member 3 (AKR7A3) ELISA Kit

Sign In for Pricing
View Details
Complement Factor B, Ba Fragment (MaxLight 405) discontinued
C7850-60D-ML405 100 µL

Complement Factor B, Ba Fragment (MaxLight 405) discontinued

Sign In for Pricing
View Details
PTOP (ACD) (NM_001082486) Human Over-expression Lysate
LS065057-100ug 100 µg

PTOP (ACD) (NM_001082486) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human LRRC73 shRNA (UAS) - Lentiviral human LRRC73 shRNA (UAS, GFP) plasmid
GTR15333205 1 Vial

Lentiviral human LRRC73 shRNA (UAS) - Lentiviral human LRRC73 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Nasopharyngeal Cells
ABC-TC005W 1 Vial

Human Nasopharyngeal Cells

Sign In for Pricing
View Details
4-Fluoro-1,2-phenylenediamine
TRC-F596350-25G 25 g

4-Fluoro-1,2-phenylenediamine

Sign In for Pricing
View Details