Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343)

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOTA-NHS-ester Hexafluorophosphate TFA Salt (Technical Grade)
TRC-D494867-10MG 10 mg

DOTA-NHS-ester Hexafluorophosphate TFA Salt (Technical Grade)

Sign In for Pricing
View Details
CACNB1 (C-term) Rabbit Polyclonal Antibody
AP50704PU-N 400 µL

CACNB1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
mLlt11 (NM_019914) Mouse Tagged ORF Clone
MG200224 10 µg

mLlt11 (NM_019914) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ahcyl2 Mouse Gene Knockout Kit (CRISPR)
KN501008 1 Kit

Ahcyl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CellBrite® Fix 555 Membrane Labeling Kit, Trial Size
#30088-T 1 Kit

CellBrite® Fix 555 Membrane Labeling Kit, Trial Size

Sign In for Pricing
View Details
Glyoxal Sodium Bisulfite (contains oligomers)
TRC-G754513-5G 5 g

Glyoxal Sodium Bisulfite (contains oligomers)

Sign In for Pricing
View Details