Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343)

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac-Taletrectinib Adipate
TRC-R949940-100MG 100 mg

Rac-Taletrectinib Adipate

Sign In for Pricing
View Details
AMPK alpha 2 (PRKAA2) (C-term) Rabbit Polyclonal Antibody
AP13880PU-N 400 µL

AMPK alpha 2 (PRKAA2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FAM83F activation kit by CRISPRa
GA114420 1 Kit

Human FAM83F activation kit by CRISPRa

Sign In for Pricing
View Details
C5orf52 (NM_001145132) Human Over-expression Lysate
LC428712 20 µg

C5orf52 (NM_001145132) Human Over-expression Lysate

Sign In for Pricing
View Details
A830018L16Rik Mouse Gene Knockout Kit (CRISPR)
KN500567 1 Kit

A830018L16Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SETD7 (NM_030648) Human Over-expression Lysate
LY403067 100 µg

SETD7 (NM_030648) Human Over-expression Lysate

Sign In for Pricing
View Details