Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343)

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1D (NM_001130057) Human Over-expression Lysate
LY427135 100 µg

EEF1D (NM_001130057) Human Over-expression Lysate

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL
BNCB2434-100 1x 100 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRIP1 Rabbit Polyclonal Antibody
TA374084 100 µL

BRIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: M2-9E3]
AM32813PU-S 100 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: M2-9E3]

Sign In for Pricing
View Details
TIMM50 Human Gene Knockout Kit (CRISPR)
KN224744LP 1 Kit

TIMM50 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP2A2 Rabbit Monoclonal Antibody [Clone ID: 23GB3250]
TA424542 100 µL

ATP2A2 Rabbit Monoclonal Antibody [Clone ID: 23GB3250]

Sign In for Pricing
View Details