Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343)

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 Recombinant Protein
91-879 0.05 mg

IL-4 Recombinant Protein

Sign In for Pricing
View Details
SNRNP27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
44961061 1.0 µg DNA

SNRNP27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LIM2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV672936 1.0 µg DNA

LIM2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TTR Monoclonal Antibody
CSB-MA351513-01 50 µg

TTR Monoclonal Antibody

Sign In for Pricing
View Details
TTR Monoclonal Antibody
CSB-MA351513-02 100 µg

TTR Monoclonal Antibody

Sign In for Pricing
View Details
Rat Ints15 Pre-designed siRNA Set A
SI206801A 1 Each

Rat Ints15 Pre-designed siRNA Set A

Sign In for Pricing
View Details