Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-05 0.02 mg (Baculovirus)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)
MBS1119130-06 1 mg (E-Coli)

Recombinant Streptococcus pneumoniae Cell cycle protein GpsB (gpsB)

Sign In for Pricing
View Details