Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2)

This Recombinant Human T cell receptor alpha variable 2 (TVA2) spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Sheep IFNg Polyclonal Antibody
GR130026 100 µg

Genorise® Sheep IFNg Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit
DL-BRCA2-Mu-01 48 Tests

Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit

Sign In for Pricing
View Details
Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit
DL-BRCA2-Mu-02 96 Tests

Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit

Sign In for Pricing
View Details
Vitamin B12
GE2859-25g 25 g

Vitamin B12

Sign In for Pricing
View Details
Muffle Box Furnace BFMF-1300-20
BFMF-1300-20 1 Unit

Muffle Box Furnace BFMF-1300-20

Sign In for Pricing
View Details
Lentiviral human TEDDM1 sgRNA gene knockout kit - Lentiviral human TEDDM1 sgRNA gene knockout kit (25)
GTR15379449 1 Vial

Lentiviral human TEDDM1 sgRNA gene knockout kit - Lentiviral human TEDDM1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details