Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2)

This Recombinant Human T cell receptor alpha variable 2 (TVA2) spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin B / PPP3R1 (BE2.1), 0.2mg/mL
BNUB2321-500 1x 500 µL

Calcineurin B / PPP3R1 (BE2.1), 0.2mg/mL

Sign In for Pricing
View Details
PDECGF (Platelet-derived Endothelial Cell Growth Factor) discontinued
376679 500 µg

PDECGF (Platelet-derived Endothelial Cell Growth Factor) discontinued

Sign In for Pricing
View Details
Human LRRC45 qPCR Primer Pair
QH67965S 200 Tests

Human LRRC45 qPCR Primer Pair

Sign In for Pricing
View Details
RPL31P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1960806 1.0 µg DNA

RPL31P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human ApoB100 receptor ELISA KIT
EF007482 96 Tests

Human ApoB100 receptor ELISA KIT

Sign In for Pricing
View Details
Actin, alpha 1 discontinued
A0761-01A-01 40 µg

Actin, alpha 1 discontinued

Sign In for Pricing
View Details