Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkB (NTRK2) (NM_001018065) Human Over-expression Lysate
LC422716 20 µg

TrkB (NTRK2) (NM_001018065) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine ANG1 Antibody Pair Set
E-KAB-0667 50 µL & 100 µg

Porcine ANG1 Antibody Pair Set

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), 0.2mg/mL
BNUB2329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), 0.2mg/mL

Sign In for Pricing
View Details
RRP12 (NM_001145114) Human Over-expression Lysate
LC428700 20 µg

RRP12 (NM_001145114) Human Over-expression Lysate

Sign In for Pricing
View Details
Sumo 3 (SUMO3) (C-term) Rabbit Polyclonal Antibody
AP11224PU-N 400 µL

Sumo 3 (SUMO3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI1D7]
CF806343 100 µg

CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI1D7]

Sign In for Pricing
View Details