Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGT, CT (Angiotensinogen, Serpin A8, Angiotensin-1, Angiotensin I, Ang I, Angiotensin-2, Angiotensin II, Ang II, Angiotensin-3, Angiotensin III, Ang III, Des-Asp[1]-angiotensin II, SERPINA8) (MaxLight 750) discontinued
A2294-48P-ML750 100 µL

AGT, CT (Angiotensinogen, Serpin A8, Angiotensin-1, Angiotensin I, Ang I, Angiotensin-2, Angiotensin II, Ang II, Angiotensin-3, Angiotensin III, Ang III, Des-Asp[1]-angiotensin II, SERPINA8) (MaxLight 750) discontinued

Sign In for Pricing
View Details
EXOSC6 Human qPCR Template Standard (NM_058219)
HK211547 1 Kit

EXOSC6 Human qPCR Template Standard (NM_058219)

Sign In for Pricing
View Details
ITGAX Antibody
orb1259678 100 µL

ITGAX Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal POP4 Antibody [Alexa Fluor 594]
NBP2-98016AF594 0.1 mL

Rabbit Polyclonal POP4 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
HLA class II histocompatibility Antigen, DQ alpha 2 chain (HRP)
319244-01 50 µg

HLA class II histocompatibility Antigen, DQ alpha 2 chain (HRP)

Sign In for Pricing
View Details
HLA class II histocompatibility Antigen, DQ alpha 2 chain (HRP)
319244-02 100 µg

HLA class II histocompatibility Antigen, DQ alpha 2 chain (HRP)

Sign In for Pricing
View Details