Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82)

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E) -2-cyano-3-[2,5-dimethyl-1- (tetrahydrofuran-2-ylmethyl) -1H-pyrrol-3-yl]acrylic acid
sc-343594A 5 g

(2E) -2-cyano-3-[2,5-dimethyl-1- (tetrahydrofuran-2-ylmethyl) -1H-pyrrol-3-yl]acrylic acid

Sign In for Pricing
View Details
Tomm22 3'UTR Lenti-reporter-Luc Vector
47285084 1.0 µg

Tomm22 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SPI1 (NM_003120) Human Over-expression Lysate
E45H06524-2 20 µg

SPI1 (NM_003120) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7225096-01 48 Well

Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7225096-02 96 Well

Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details
Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7225096-03 5x 96 Well

Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit

Sign In for Pricing
View Details