Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82)

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC2-set siRNA/shRNA/RNAi Lentivector (Human)
50789091 4x 500 ng

ZDHHC2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit anti-FCH02 Antibody, Affinity Purified
A304-560A 100 µg

Rabbit anti-FCH02 Antibody, Affinity Purified

Sign In for Pricing
View Details
2,5-Dimethyl-3-nitrobenzoic acid
FD70544-01 1000 mg

2,5-Dimethyl-3-nitrobenzoic acid

Sign In for Pricing
View Details
2,5-Dimethyl-3-nitrobenzoic acid
FD70544-02 2000 mg

2,5-Dimethyl-3-nitrobenzoic acid

Sign In for Pricing
View Details
2,5-Dimethyl-3-nitrobenzoic acid
FD70544-03 5000 mg

2,5-Dimethyl-3-nitrobenzoic acid

Sign In for Pricing
View Details
Mastoparan 7 Peptide
abx266647-01 1 mg

Mastoparan 7 Peptide

Sign In for Pricing
View Details