Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82)

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK-2; ACVR1 Protein (C-His, Human)
P513141 100 µg

ALK-2; ACVR1 Protein (C-His, Human)

Sign In for Pricing
View Details
Fam220a (NM_001017485) Rat Tagged Lenti ORF Clone
RR212703L3 10 µg

Fam220a (NM_001017485) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Osbpl9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4842908 1.0 µg DNA

Osbpl9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
D330028D13Rik Protein Vector (Mouse) (pPM-C-HA)
PV170140 500 ng

D330028D13Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Hist1h2bp CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23350154 3x 1.0 µg DNA

Hist1h2bp CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CwlA Antibody
orb812716 2 mg

CwlA Antibody

Sign In for Pricing
View Details