Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12)

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12) spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFQ1
#80501 1x 5 mg

NFQ1

Sign In for Pricing
View Details
Human ANKRD30B activation kit by CRISPRa
GA117779 1 Kit

Human ANKRD30B activation kit by CRISPRa

Sign In for Pricing
View Details
KLHL10 Human Gene Knockout Kit (CRISPR)
KN422526 1 Kit

KLHL10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CFLAR Antibody
8C12187-AAT 50 µg

CFLAR Antibody

Sign In for Pricing
View Details
Recombinant Human HAO1 Protein (His Tag)
PKSH033344-01 10 µg

Recombinant Human HAO1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HAO1 Protein (His Tag)
PKSH033344-02 50 µg

Recombinant Human HAO1 Protein (His Tag)

Sign In for Pricing
View Details