Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor) (Not for Export EU)
A4152-30E 100 µL

Atrial Natriuretic Peptide (ANP, Atrial Natriuretic Factor) (Not for Export EU)

Sign In for Pricing
View Details
Mouse LIM domain-binding protein 1 (LDB1) ELISA Kit
abx530827 96 Tests

Mouse LIM domain-binding protein 1 (LDB1) ELISA Kit

Sign In for Pricing
View Details
TRNAK34 Protein Vector (Human) (pPB-N-His)
PV139199 500 ng

TRNAK34 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-FLAG-tag Antibody-AF594 labled
BS22298-01 100 µL

Anti-FLAG-tag Antibody-AF594 labled

Sign In for Pricing
View Details
Anti-FLAG-tag Antibody-AF594 labled
BS22298-02 500 µL

Anti-FLAG-tag Antibody-AF594 labled

Sign In for Pricing
View Details
Mcm10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4780808 1.0 µg DNA

Mcm10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details