Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iomeprol-d3
TRC-I730502-1MG 1 mg

Iomeprol-d3

Sign In for Pricing
View Details
Diethyl 1,1-Cyclobutanedicarboxylate
TRC-D444170-5G 5 g

Diethyl 1,1-Cyclobutanedicarboxylate

Sign In for Pricing
View Details
Human ECHDC3 activation kit by CRISPRa
GA112597 1 Kit

Human ECHDC3 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Equine IgG, Fc Specific,  20nm
GAF-432-20 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Equine IgG, Fc Specific, 20nm

Sign In for Pricing
View Details
Desacetyl Bisacodyl Beta-D-Glucuronide
TRC-D288650-10MG 10 mg

Desacetyl Bisacodyl Beta-D-Glucuronide

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF568 conjugate, 0.1mg/mL
BNC682039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details