Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

80% Glycerol solution
IBS-BG006-1 500 mL

80% Glycerol solution

Sign In for Pricing
View Details
Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP
MBS1584091-01 50 Tests

Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP

Sign In for Pricing
View Details
Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP
MBS1584091-02 100 Tests

Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP

Sign In for Pricing
View Details
Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP
MBS1584091-03 5x 100 Tests

Anti-Human CD309/KDR/VEGFR-2 Antibody (1121B), PerCP

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (A9E4), CF640R conjugate, 0.1mg/mL
BNC400309-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (A9E4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus ebhB Protein (aa 1-3890) (strain Mu3 / ATCC 700698)
VAng-Cr5717-inquire Inquire

Recombinant Staphylococcus Aureus ebhB Protein (aa 1-3890) (strain Mu3 / ATCC 700698)

Sign In for Pricing
View Details