Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86)

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Air Cooled Chiller BCHI-114
BCHI-114 Each

Air Cooled Chiller BCHI-114

Sign In for Pricing
View Details
Human UFSP2 activation kit by CRISPRa
GA110705 1 Kit

Human UFSP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse BTLA Protein, Fc Tag (MALS verified)
BTA-M5253-1mg 1 mg

Mouse BTLA Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details
Recombinant Swine Flt-3 Ligand protein (His Tag)
PKSS000013-01 5 µg

Recombinant Swine Flt-3 Ligand protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine Flt-3 Ligand protein (His Tag)
PKSS000013-02 20 µg

Recombinant Swine Flt-3 Ligand protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505707 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details