Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86)

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EXOSC6 activation kit by CRISPRa
GA114660 1 Kit

Human EXOSC6 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Aminopyrene
TRC-A577178-50MG 50 mg

4-Aminopyrene

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL
BNC472210-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein
TP331187M 100 µg

C10orf81 (PLEKHS1) (NM_001193434) Human Recombinant Protein

Sign In for Pricing
View Details
CD74 (BU45), 0.2mg/mL
BNUB0189-500 1x 500 µL

CD74 (BU45), 0.2mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), 0.2mg/mL
BNUB0819-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), 0.2mg/mL

Sign In for Pricing
View Details