Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2)

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Necrosulfonamide Propyl Amide
TRC-B390950-25MG 25 mg

Biotin-Necrosulfonamide Propyl Amide

Sign In for Pricing
View Details
PI 3 Kinase p85 alpha (PIK3R1) (NM_181523) Human Recombinant Protein
TP710387 20 µg

PI 3 Kinase p85 alpha (PIK3R1) (NM_181523) Human Recombinant Protein

Sign In for Pricing
View Details
Canine Tryptase (TPS) ELISA Kit
RD-TPS-c-01 96 Tests

Canine Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Canine Tryptase (TPS) ELISA Kit
RD-TPS-c-02 48 Tests

Canine Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1), CF594 conjugate, 0.1mg/mL
BNC941741-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/326), CF647 conjugate, 0.1mg/mL
BNC470326-500 1x 500 µL

Serum Amyloid A (SAA/326), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details