Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2)

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipin 3 Antibody
orb1317108 100 µL

Lipin 3 Antibody

Sign In for Pricing
View Details
EIF2AK2 (PKR, PRKR, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, Interferon-inducible RNA-dependent Protein Kinase, P1/eIF-2A Protein Kinase, Protein Kinase RNA-activated, Tyrosine-protein Kinase EIF2AK2, p68 Kinase, MGC126524) (MaxLight 750) discontinued
126222-ML750 100 µL

EIF2AK2 (PKR, PRKR, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, Interferon-inducible RNA-dependent Protein Kinase, P1/eIF-2A Protein Kinase, Protein Kinase RNA-activated, Tyrosine-protein Kinase EIF2AK2, p68 Kinase, MGC126524) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Transglutaminase, CT (Tissue transglutaminase, TGase C, TGC, TG (C), Transglutaminase-2, TGase-H, TGM2) (Biotin) discontinued
043194-Biotin 200 µL

Transglutaminase, CT (Tissue transglutaminase, TGase C, TGC, TG (C), Transglutaminase-2, TGase-H, TGM2) (Biotin) discontinued

Sign In for Pricing
View Details
SIRT5 Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124273-01 0.1 mL

SIRT5 Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
SIRT5 Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124273-02 5x 0.1 mL

SIRT5 Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
L-Ornithine Monohydrochloride 99% For Biochemistry
189700025 25 mg

L-Ornithine Monohydrochloride 99% For Biochemistry

Sign In for Pricing
View Details