Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf72 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]
TA501562AM 100 µL

C16orf72 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]

Sign In for Pricing
View Details
UBE2E3 (N-term) Rabbit Polyclonal Antibody
AP12081PU-N 400 µL

UBE2E3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGFalpha (P/T1), CF640R conjugate, 0.1mg/mL
BNC400787-500 1x 500 µL

TGFalpha (P/T1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cy3B TCO
946-AAT 1 mg

Cy3B TCO

Sign In for Pricing
View Details
PARC (CUL9) Rabbit Polyclonal Antibody
AP07615SU-N 50 µL

PARC (CUL9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thumpd2 Mouse Gene Knockout Kit (CRISPR)
KN517549 1 Kit

Thumpd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details