Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Euonymus europaeus Lectin (Spindle Tree) -EEA-
BA-4201-2 2 mg

Biotin Conjugated Euonymus europaeus Lectin (Spindle Tree) -EEA-

Sign In for Pricing
View Details
Recombinant Rat CD111/Nectin-1 Protein (Fc Tag)
PKSR030291 100 µg

Recombinant Rat CD111/Nectin-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Penicillic Acid
TRC-P223530-5MG 5 mg

Penicillic Acid

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3348), CF647 conjugate, 0.1mg/mL
BNC473348-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3348), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4'-Hydroxy-PhIP
TRC-H950760-1MG 1 mg

4'-Hydroxy-PhIP

Sign In for Pricing
View Details
CD1C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]
TA505401AM 100 µL

CD1C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]

Sign In for Pricing
View Details