Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QB (E3U6X) Rabbit Monoclonal Antibody (BSA and Azide Free)
CST 43159SF 100 µg

C1QB (E3U6X) Rabbit Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
Tmem214 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6258303 1.0 µg DNA

Tmem214 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral human WDR37 sgRNA gene knockout kit - Lentiviral human WDR37 sgRNA gene knockout kit (25)
GTR15397080 1 Vial

Lentiviral human WDR37 sgRNA gene knockout kit - Lentiviral human WDR37 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Cma2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
16401124 3x 1.0µg DNA

Cma2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Thioredoxin Chemiluminescent Immunoassay Kit
IMSTXNKTC 1 Each

Mouse Thioredoxin Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
Acid-C1-PEG5-Boc
MBS3615488-01 2 mg

Acid-C1-PEG5-Boc

Sign In for Pricing
View Details