Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3)

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psg27 siRNA (m)
sc-152551 10 µM

Psg27 siRNA (m)

Sign In for Pricing
View Details
Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (AP) discontinued
F4100-05N-AP 100 µL

Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (AP) discontinued

Sign In for Pricing
View Details
Human IgG (Fd region) Mouse Monoclonal Antibody [Clone ID: HP6045]
AM31855RP-N 50 µg

Human IgG (Fd region) Mouse Monoclonal Antibody [Clone ID: HP6045]

Sign In for Pricing
View Details
Rabbit Polyclonal Girdin [p Tyr1764] Antibody
NBP3-23352 0.1 mL

Rabbit Polyclonal Girdin [p Tyr1764] Antibody

Sign In for Pricing
View Details
PSMG2 Mouse Monoclonal Antibody [Clone ID: LBI3F1]
AMM18401V 100 µL

PSMG2 Mouse Monoclonal Antibody [Clone ID: LBI3F1]

Sign In for Pricing
View Details
Anti-TRAF4 Antibody Picoband®, Cy3 Conjugate
PA2009-Cy3 100 µg/Vial

Anti-TRAF4 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details