Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3)

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1 (ERCC1) Antibody
abx010742 100 µg

Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1 (ERCC1) Antibody

Sign In for Pricing
View Details
Pdgfrb sgRNA CRISPR Lentivector set (Rat)
K6783401 3x 1.0 µg

Pdgfrb sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human NANS Protein, His Tag
KMH1428-01 100 µg

Recombinant Human NANS Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human NANS Protein, His Tag
KMH1428-02 50 µg

Recombinant Human NANS Protein, His Tag

Sign In for Pricing
View Details
Mouse Bcl-2-like protein 11 (BCL2L11) ELISA Kit
MBS7250944-01 48 Well

Mouse Bcl-2-like protein 11 (BCL2L11) ELISA Kit

Sign In for Pricing
View Details
Mouse Bcl-2-like protein 11 (BCL2L11) ELISA Kit
MBS7250944-02 96 Well

Mouse Bcl-2-like protein 11 (BCL2L11) ELISA Kit

Sign In for Pricing
View Details