Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL32 activation kit by CRISPRa
GA114457 1 Kit

Human KLHL32 activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF740 conjugate, 0.1mg/mL
BNC743283-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TICAM2 (TMED7-TICAM2) (NM_001164469) Human Recombinant Protein
TP328121M 100 µg

TICAM2 (TMED7-TICAM2) (NM_001164469) Human Recombinant Protein

Sign In for Pricing
View Details
Human Neuropilin 2 (NRP2) ELISA Kit
RD-NRP2-Hu-01 96 Tests

Human Neuropilin 2 (NRP2) ELISA Kit

Sign In for Pricing
View Details
Human Neuropilin 2 (NRP2) ELISA Kit
RD-NRP2-Hu-02 48 Tests

Human Neuropilin 2 (NRP2) ELISA Kit

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF594 conjugate, 0.1mg/mL
BNC942094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details