Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCC (Center) Rabbit Polyclonal Antibody
AP51195PU-N 400 µL

DCC (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit
RDR-IL4-Hu-01 96 Tests

Human Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 4 (IL4) ELISA Kit
RDR-IL4-Hu-02 48 Tests

Human Interleukin 4 (IL4) ELISA Kit

Sign In for Pricing
View Details
SP3/4 Antibody
8C10849-AAT 50 µg

SP3/4 Antibody

Sign In for Pricing
View Details
6-FAM, SE [6-Carboxyfluorescein, succinimidyl ester] *CAS 92557-81-8*
116-AAT 10 mg

6-FAM, SE [6-Carboxyfluorescein, succinimidyl ester] *CAS 92557-81-8*

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF740 conjugate, 0.1mg/mL
BNC741792-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1792), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details