Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF563, NT (ZNF563, Zinc finger protein 563) (MaxLight 750) discontinued
044284-ML750 100 µL

ZNF563, NT (ZNF563, Zinc finger protein 563) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACOX2 Rabbit Polyclonal Antibody (BF680)
orb2414216 100 µL

ACOX2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Human Gelsolin (GS) ELISA Kit
NSL2051Hu 96 Tests

Human Gelsolin (GS) ELISA Kit

Sign In for Pricing
View Details
IFITM1 Human Gene Knockout Kit (CRISPR)
KN201617 1 Kit

IFITM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTRP1 HDR Plasmid (m)
sc-425289-HDR 20 µg

CTRP1 HDR Plasmid (m)

Sign In for Pricing
View Details
ZDHHC5 Recombinant Protein Antigen
NBP1-81376PEP 0.1 mL

ZDHHC5 Recombinant Protein Antigen

Sign In for Pricing
View Details