Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pseudostratified columnar epithelium, in sec. through epididymis
Ma1145d 7.6 x 2.6 cm

Pseudostratified columnar epithelium, in sec. through epididymis

Sign In for Pricing
View Details
Mouse PRDX3 shRNA Plasmid
abx969154-01 150 µg

Mouse PRDX3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PRDX3 shRNA Plasmid
abx969154-02 300 µg

Mouse PRDX3 shRNA Plasmid

Sign In for Pricing
View Details
Bovine VWF ELISA Kit
E102782-01 1 Each

Bovine VWF ELISA Kit

Sign In for Pricing
View Details
Bovine VWF ELISA Kit
E102782-02 1 Each

Bovine VWF ELISA Kit

Sign In for Pricing
View Details
Anti-S6A18 SLC6A18 Antibody
A10812 100 µL

Anti-S6A18 SLC6A18 Antibody

Sign In for Pricing
View Details