Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947) APC
MBS6137197-01 0.1 mL

IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947) APC

Sign In for Pricing
View Details
IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947) APC
MBS6137197-02 5x 0.1 mL

IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947) APC

Sign In for Pricing
View Details
Luria-Bertani (LB) Agar Plates w/ Chlor-25 & 1% Starch
30629358-5 80 Plates

Luria-Bertani (LB) Agar Plates w/ Chlor-25 & 1% Starch

Sign In for Pricing
View Details
N-Acetyl-L-aspartic acid 100mg
A18976-100 100 mg

N-Acetyl-L-aspartic acid 100mg

Sign In for Pricing
View Details
DACT1 AAV Vector (Mouse) (CMV)
17638104 1 µg

DACT1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Zmym2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4726905 3x 1.0 µg

Zmym2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details