Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-Tryptophan octyl ester (hydrochloride)
orb1692299-01 500 mg

DL-Tryptophan octyl ester (hydrochloride)

Sign In for Pricing
View Details
DL-Tryptophan octyl ester (hydrochloride)
orb1692299-02 1 g

DL-Tryptophan octyl ester (hydrochloride)

Sign In for Pricing
View Details
DL-Tryptophan octyl ester (hydrochloride)
orb1692299-03 5 g

DL-Tryptophan octyl ester (hydrochloride)

Sign In for Pricing
View Details
Bis-Tris Propane Buffer 0.2M, pH 7.0
40220017-2 250 mL

Bis-Tris Propane Buffer 0.2M, pH 7.0

Sign In for Pricing
View Details
CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110) discontinued, see C2446-87
C2446-79 500 µg

CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110) discontinued, see C2446-87

Sign In for Pricing
View Details
Mouse IGSF9 Alexa Fluor 350 MAb (Clone 993107)
FAB9140U-100UG 100 µg

Mouse IGSF9 Alexa Fluor 350 MAb (Clone 993107)

Sign In for Pricing
View Details