Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKA IIα reg (H-12) Alexa Fluor® 488
sc-137220 AF488 200 µg/mL

PKA IIα reg (H-12) Alexa Fluor® 488

Sign In for Pricing
View Details
NMDAR2A antibody
70R-13741 100 ug

NMDAR2A antibody

Sign In for Pricing
View Details
Pik3cd ORF Vector (Mouse) (pORF)
ORF054055 1.0 µg DNA

Pik3cd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FLT3/Flk-2[Biotin], His & Avi, Human
Z04466-500 500 µg

FLT3/Flk-2[Biotin], His & Avi, Human

Sign In for Pricing
View Details
Met (Ab003) Antibody
21548-01 50 µL

Met (Ab003) Antibody

Sign In for Pricing
View Details
Met (Ab003) Antibody
21548-02 100 µL

Met (Ab003) Antibody

Sign In for Pricing
View Details