Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40)

This Recombinant Human T cell receptor alpha variable 40 (TVA40) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEA1 Antibody
orb1312529-01 30 µL

EEA1 Antibody

Sign In for Pricing
View Details
EEA1 Antibody
orb1312529-02 50 μL

EEA1 Antibody

Sign In for Pricing
View Details
EEA1 Antibody
orb1312529-03 100 µL

EEA1 Antibody

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)
MBS6181576-01 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)
MBS6181576-02 5x 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)

Sign In for Pricing
View Details
Triethyl Orthoformate (Ethyl Orthoformate, Orthoformic Acid, tri-Ethyl Ester, Triethoxy Methane)
247665-01 500 mL

Triethyl Orthoformate (Ethyl Orthoformate, Orthoformic Acid, tri-Ethyl Ester, Triethoxy Methane)

Sign In for Pricing
View Details