Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF640R conjugate, 0.1mg/mL
BNC403792-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,6-Anhydro-beta-D-mannopyranose
TRC-A652500-1G 1 g

1,6-Anhydro-beta-D-mannopyranose

Sign In for Pricing
View Details
Irganox 1141 (>85%)
TRC-I101215-10MG 10 mg

Irganox 1141 (>85%)

Sign In for Pricing
View Details
OMG Polyclonal Antibody
E-AB-16668-01 20 µL

OMG Polyclonal Antibody

Sign In for Pricing
View Details
OMG Polyclonal Antibody
E-AB-16668-02 60 µL

OMG Polyclonal Antibody

Sign In for Pricing
View Details
OMG Polyclonal Antibody
E-AB-16668-03 120 µL

OMG Polyclonal Antibody

Sign In for Pricing
View Details