Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Fluoroacetate
TRC-S960143-50MG 50 mg

Sodium Fluoroacetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701592 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
NSUN6 Human Gene Knockout Kit (CRISPR)
KN207817RB 1 Kit

NSUN6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713729 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Glycocholic Acid Hydrate Sodium Salt
TRC-G641360-5G 5 g

Glycocholic Acid Hydrate Sodium Salt

Sign In for Pricing
View Details
Succinimidyl 6- (4,4´-azipentanamido) hexanoate [NHS-LC-Diazirine]
39002-AAT 5x 1 mg

Succinimidyl 6- (4,4´-azipentanamido) hexanoate [NHS-LC-Diazirine]

Sign In for Pricing
View Details