Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBF3 Human Gene Knockout Kit (CRISPR)
KN415222 1 Kit

EBF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LysoViewTM 680, 1000X in DMSO, Trial Size
#70086-T 1x 10 µL

LysoViewTM 680, 1000X in DMSO, Trial Size

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS705613 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
3-Hydroxy-2-naphthoic acid
TRC-H951078-500MG 500 mg

3-Hydroxy-2-naphthoic acid

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR560261 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
Senecionine N-Oxide-D3
TRC-S258657-1MG 1 mg

Senecionine N-Oxide-D3

Sign In for Pricing
View Details