Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13)

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Signal Transducer and Activator of Transcription 5 (STAT5) ELISA Kit
MBS9366744 Inquire

Fish Signal Transducer and Activator of Transcription 5 (STAT5) ELISA Kit

Sign In for Pricing
View Details
Fam110b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4958306 1.0 µg DNA

Fam110b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit
abx151123-01 96 Tests

Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit
abx151123-02 5x 96 Tests

Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit
abx151123-03 10x 96 Tests

Human Collagen Type IX Alpha 3 (COL9A3) ELISA Kit

Sign In for Pricing
View Details
Swab PS Dacron Tip in Tube
SWA1022 250 / PCK

Swab PS Dacron Tip in Tube

Sign In for Pricing
View Details