Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621)

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PLA2G1B Protein, His, E.coli-1mg
QP13072-1mg 1mg

Recombinant Human PLA2G1B Protein, His, E.coli-1mg

Sign In for Pricing
View Details
PTP1B Antibody Blocking peptide
orb1445249 500 µg

PTP1B Antibody Blocking peptide

Sign In for Pricing
View Details
GPR111 siRNA Oligos set (Human)
22485171 3x 5 nmol

GPR111 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Antibody
abx171095-01 100 µL

Adiponectin (ADIPOQ) Antibody

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Antibody
abx171095-02 200 µL

Adiponectin (ADIPOQ) Antibody

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Antibody
abx171095-03 1 mL

Adiponectin (ADIPOQ) Antibody

Sign In for Pricing
View Details