Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20)

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20) spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4) (MaxLight 650)
124754-ML650 100 µL

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4) (MaxLight 650)

Sign In for Pricing
View Details
H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
FL109362-01 250 mg

H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt

Sign In for Pricing
View Details
H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
FL109362-02 500 mg

H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt

Sign In for Pricing
View Details
H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
FL109362-03 1000 mg

H-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt

Sign In for Pricing
View Details
LYPD1 CRISPR Knock Out 293T Cell Line (Human)
27837141 1x 10^6 Cells / 1.0 mL

LYPD1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CLASP1 (NM_015282) Human Tagged ORF Clone Lentiviral Particle
RC217019L4V 200 µL

CLASP1 (NM_015282) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details