Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8)

This Recombinant Human T cell receptor gamma variable 8 (TRGV8) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD12 (NM_207335) Human Over-expression Lysate
LC403962 20 µg

KBTBD12 (NM_207335) Human Over-expression Lysate

Sign In for Pricing
View Details
Tegoprazan
TRC-T145030-5MG 5 mg

Tegoprazan

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF405S conjugate, 0.1mg/mL
BNC042167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuantiFluo™ Diamine Oxidase Assay Kit
QFDO-100 100 Tests

QuantiFluo™ Diamine Oxidase Assay Kit

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD28 Antibody[37.51]
E-AB-F1026UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD28 Antibody[37.51]
E-AB-F1026UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD28 Antibody[37.51]

Sign In for Pricing
View Details