Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8)

This Recombinant Human T cell receptor gamma variable 8 (TRGV8) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-DL-tryptophan
TRC-C423220-50MG 50 mg

5-Chloro-DL-tryptophan

Sign In for Pricing
View Details
Bisphenol E-13C6
TRC-B519482-1MG 1 mg

Bisphenol E-13C6

Sign In for Pricing
View Details
Human RABEP2 activation kit by CRISPRa
GA112696 1 Kit

Human RABEP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Isocarbofos D7 (isopropyl D7)
TRC-I923521-5MG 5 mg

Isocarbofos D7 (isopropyl D7)

Sign In for Pricing
View Details
1,3-Diacetoxypropane
TRC-D307573-500MG 500 mg

1,3-Diacetoxypropane

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-03 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details