Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 4 (TRGV4)

This Recombinant Human T cell receptor gamma variable 4 (TRGV4) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 4 TRGV4 TCRGV4

UniProt

A0A0C4DH28

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAT2 CRISPR Knock Out 293T Cell Line (Human)
20264141 1x 10^6 Cells / 1.0 mL

FAT2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PIF6 Polyclonal Antibody
MBS9003060 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PIF6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bat coronavirus 133/2005 Envelope small membrane protein (E), partial
MBS7073278 Inquire

Recombinant Bat coronavirus 133/2005 Envelope small membrane protein (E), partial

Sign In for Pricing
View Details
(Z) -Ligustilide-d7
HY-N0401AS 1 mg

(Z) -Ligustilide-d7

Sign In for Pricing
View Details
Polyclonal Goat Anti-RNF39 / LIRF Antibody
APR12170G 0.1 mg

Polyclonal Goat Anti-RNF39 / LIRF Antibody

Sign In for Pricing
View Details
Mouse Cdh22 activation kit by CRISPRa
GA211778 1 Kit

Mouse Cdh22 activation kit by CRISPRa

Sign In for Pricing
View Details