Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-16 (HV316) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-16 IGHV3-16

UniProt

A0A0C4DH30

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWARKAPGKGLEWVSGVSWNGSRTHYVDSVKRRFIISRDNSRNSLYLQKNRRRAEDMAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL12 (Interleukin 12) ELISA Kit
MBS8808164-01 48 Well

Rat IL12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
Rat IL12 (Interleukin 12) ELISA Kit
MBS8808164-02 96 Well

Rat IL12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
Rat IL12 (Interleukin 12) ELISA Kit
MBS8808164-03 5x 96 Well

Rat IL12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
Rat IL12 (Interleukin 12) ELISA Kit
MBS8808164-04 10x 96 Well

Rat IL12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
PSMD3 Antibody - middle region : HRP (ARP56480_P050-HRP)
ARP56480_P050-HRP 100 µL

PSMD3 Antibody - middle region : HRP (ARP56480_P050-HRP)

Sign In for Pricing
View Details
S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) (AP) discontinued
132919-AP 100 µL

S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) (AP) discontinued

Sign In for Pricing
View Details